PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G00430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family ARF
Protein Properties Length: 685aa    MW: 76359.6 Da    PI: 5.8936
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G00430genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B361.21.7e-19124212184
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                 f+k+lt sd++++g +++ +++a+++       +++    ++l+ +d++g +W +++i+r++++r++lt+GW+ Fv++++L +gD ++F +
  AA53G00430 124 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVATDLHGIEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLR 212
                 99****************************964333..4459***********************************************84 PP

2Auxin_resp109.92.7e-36277359183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aaha++t+++F+v+Y+Pr+s+seF+v+++++++a ++k+svGmRfkm+fe+e+++err+sGt vgv++ +++ W nS+WrsLk
  AA53G00430 277 AAHAIKTGTIFSVFYKPRTSRSEFIVSINRYLEAKNQKLSVGMRFKMRFEGEEAPERRFSGTTVGVQENKSTVWLNSEWRSLK 359
                 79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.53E-40113280IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.2E-35121266IPR015300DNA-binding pseudobarrel domain
CDDcd100173.17E-17122210No hitNo description
SMARTSM010193.5E-16124227IPR003340B3 DNA binding domain
PROSITE profilePS508639.841124229IPR003340B3 DNA binding domain
PfamPF023621.3E-17124212IPR003340B3 DNA binding domain
PfamPF065073.5E-33277359IPR010525Auxin response factor
PfamPF023095.1E-5558597IPR033389AUX/IAA domain
PROSITE profilePS5174528.566561654IPR000270PB1 domain
SuperFamilySSF542779.81E-11563638No hitNo description
PfamPF023094.7E-6602651IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MAASNHSSGR PGGVLSDALY RELWHACAGP LVTLPREGER VYYFPEGHME QLEASMHQGL  60
EQQIPSFNLP SKILCKVINI QRRAEPETDE VYAQITLLPE PDQSEPMSLD PPVPEPEKCT  120
VHSFCKTLTA SDTSTHGGFS VLRRHADDCL PPLDMSQQPP WQELVATDLH GIEWHFRHIF  180
RGQPRRHLLT TGWSVFVSSK KLVAGDAFIF LRQVPQHSNV LDIILSSDVE QCDIVFISRG  240
ENEELRVGVR RHIKQQTNIP SSVISSHSMH IGVLATAAHA IKTGTIFSVF YKPRTSRSEF  300
IVSINRYLEA KNQKLSVGMR FKMRFEGEEA PERRFSGTTV GVQENKSTVW LNSEWRSLKV  360
QWDEPSSVIR PESVSPWEID PLVANNTPAS HTQPPQRNKR QRPPGLPSPT TGSSTPGVWK  420
SSTETPCLVP LFSHPAKTST FGHGGNKSSG SAFWPSHGDS ATESFASVFN NESTEKKQAN  480
GSVCRLFGFE LVENGNVDEC FSGASVSGNV TGDQPVLSNE FDSPQQSEQL NINQCNIPSG  540
SGDPEKSSLR SPQESLSRQI RSCTKVHMQG SAVGRAVDLT QSECYEELFK KLEVMFDIEG  600
ELLGSTKKWQ VVYTDDEDDM MMVGDDPWNE FCGMVRKIYI YTPEEVKKLS PKNRFIVAEG  660
MQLKTDAEED MNTEDNRSSS MAGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B0.013821355Auxin response factor 1
4ldw_A0.013821355Auxin response factor 1
4ldv_A0.013821355Auxin response factor 1
4ldx_B0.013821355Auxin response factor 1
4ldx_A0.013821355Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_849830.10.0auxin response factor 1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLB9DGM90.0B9DGM9_ARATH; Auxin response factor
STRINGAT1G59750.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88252227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1